| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145503.1 | internal | 184 | 552-1(-) |
Amino Acid sequence : | |||
| SQKREQPQDDQRTARINDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGV SFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDDEGSNTREPNPNGTSDILTALICSC | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 18,863.086 | ||
| Theoretical pI: | 6.406 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 56.739 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.679 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.236 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145503.1 | 5prime_partial | 165 | 2-499(+) |
Amino Acid sequence : | |||
| HEQIKAVKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKF LRRFRMPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 18,863.086 | ||
| Theoretical pI: | 6.406 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 56.739 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.679 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.236 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145503.1 | internal | 184 | 552-1(-) |
Amino Acid sequence : | |||
| SQKREQPQDDQRTARINDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGV SFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDDEGSNTREPNPNGTSDILTALICSC | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 18,863.086 | ||
| Theoretical pI: | 6.406 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 56.739 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.679 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.236 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145503.1 | 5prime_partial | 165 | 2-499(+) |
Amino Acid sequence : | |||
| HEQIKAVKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKF LRRFRMPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 18,863.086 | ||
| Theoretical pI: | 6.406 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 56.739 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.679 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.236 | ||
| sheet | 0.230 | ||