| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145504.1 | internal | 180 | 2-541(+) |
Amino Acid sequence : | |||
| LERNFQDFDNFYEHVIDEHIMNSKGREDQDRGAEDFLHTLLNMKKLAGTQLTNEHIKGMLMNIFIGGTYTSSAVVEWIFTELIKKPAAMKKAQDEVRSVVGSKGKVEEIDLDQLHYLKCI VKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPER | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 13,218.421 | ||
| Theoretical pI: | 9.192 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 38.380 | ||
| aromaticity | 0.165 | ||
| GRAVY | 0.043 | ||
Secondary Structure Fraction | |||
| Helix | 0.422 | ||
| turn | 0.202 | ||
| sheet | 0.174 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145504.1 | 5prime_partial | 109 | 541-212(-) |
Amino Acid sequence : | |||
| SLRIEFIRIFPNICIPSHRKCIYNQPRFGWYVITIDPTVLHCFSFVKQWSYRMQSHRLLNNTLEIMKLVKVNLLDLPLASDNTSHFVLCFLHCGWFFNELRKYPFYDCR* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 13,218.421 | ||
| Theoretical pI: | 9.192 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 38.380 | ||
| aromaticity | 0.165 | ||
| GRAVY | 0.043 | ||
Secondary Structure Fraction | |||
| Helix | 0.422 | ||
| turn | 0.202 | ||
| sheet | 0.174 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145504.1 | internal | 180 | 2-541(+) |
Amino Acid sequence : | |||
| LERNFQDFDNFYEHVIDEHIMNSKGREDQDRGAEDFLHTLLNMKKLAGTQLTNEHIKGMLMNIFIGGTYTSSAVVEWIFTELIKKPAAMKKAQDEVRSVVGSKGKVEEIDLDQLHYLKCI VKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPER | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 13,218.421 | ||
| Theoretical pI: | 9.192 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 38.380 | ||
| aromaticity | 0.165 | ||
| GRAVY | 0.043 | ||
Secondary Structure Fraction | |||
| Helix | 0.422 | ||
| turn | 0.202 | ||
| sheet | 0.174 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145504.1 | 5prime_partial | 109 | 541-212(-) |
Amino Acid sequence : | |||
| SLRIEFIRIFPNICIPSHRKCIYNQPRFGWYVITIDPTVLHCFSFVKQWSYRMQSHRLLNNTLEIMKLVKVNLLDLPLASDNTSHFVLCFLHCGWFFNELRKYPFYDCR* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 13,218.421 | ||
| Theoretical pI: | 9.192 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 38.380 | ||
| aromaticity | 0.165 | ||
| GRAVY | 0.043 | ||
Secondary Structure Fraction | |||
| Helix | 0.422 | ||
| turn | 0.202 | ||
| sheet | 0.174 | ||