Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145520.1 | internal | 107 | 2-322(+) |
Amino Acid sequence : | |||
DFQEVKIPLDIMIYKLVKAYICSSSLRKSALRALAKTLTVPQLSYLREQFSLLGPTKTGYISMQNFKTALMKCSTEAMKDSKVLDFINVVCSLQYRKLDFEEFAAAS | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,143.194 | ||
Theoretical pI: | 9.198 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 21.614 | ||
aromaticity | 0.103 | ||
GRAVY | 0.075 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.168 | ||
sheet | 0.299 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145520.1 | internal | 107 | 2-322(+) |
Amino Acid sequence : | |||
DFQEVKIPLDIMIYKLVKAYICSSSLRKSALRALAKTLTVPQLSYLREQFSLLGPTKTGYISMQNFKTALMKCSTEAMKDSKVLDFINVVCSLQYRKLDFEEFAAAS | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,143.194 | ||
Theoretical pI: | 9.198 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 21.614 | ||
aromaticity | 0.103 | ||
GRAVY | 0.075 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.168 | ||
sheet | 0.299 |