| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145520.1 | internal | 107 | 2-322(+) |
Amino Acid sequence : | |||
| DFQEVKIPLDIMIYKLVKAYICSSSLRKSALRALAKTLTVPQLSYLREQFSLLGPTKTGYISMQNFKTALMKCSTEAMKDSKVLDFINVVCSLQYRKLDFEEFAAAS | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,143.194 | ||
| Theoretical pI: | 9.198 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 21.614 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.168 | ||
| sheet | 0.299 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145520.1 | internal | 107 | 2-322(+) |
Amino Acid sequence : | |||
| DFQEVKIPLDIMIYKLVKAYICSSSLRKSALRALAKTLTVPQLSYLREQFSLLGPTKTGYISMQNFKTALMKCSTEAMKDSKVLDFINVVCSLQYRKLDFEEFAAAS | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,143.194 | ||
| Theoretical pI: | 9.198 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 21.614 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.168 | ||
| sheet | 0.299 | ||