| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145524.1 | 5prime_partial | 202 | 2-610(+) |
Amino Acid sequence : | |||
| HERIHRFLQFHTMPSHQTPNSNKGLGIVIIGVSGSGKSTVAKTLAKSLGCSFFEADDFHSQANKEKMSKGIPLTDEDRTPWLETLRDAIRTKLDAGETVTVTCSALQKRYREILRSADPE YECGDYANCKLRFVCLEAPTELLASRISVRSENEKHFMPVSLLKSQLELLQIDRAEGIDMVDTRAGLQYSVDSILSLLTTDN* | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 22,574.396 | ||
| Theoretical pI: | 6.097 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 41.239 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.363 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.213 | ||
| sheet | 0.272 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145524.1 | 5prime_partial | 202 | 2-610(+) |
Amino Acid sequence : | |||
| HERIHRFLQFHTMPSHQTPNSNKGLGIVIIGVSGSGKSTVAKTLAKSLGCSFFEADDFHSQANKEKMSKGIPLTDEDRTPWLETLRDAIRTKLDAGETVTVTCSALQKRYREILRSADPE YECGDYANCKLRFVCLEAPTELLASRISVRSENEKHFMPVSLLKSQLELLQIDRAEGIDMVDTRAGLQYSVDSILSLLTTDN* | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 22,574.396 | ||
| Theoretical pI: | 6.097 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 41.239 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.363 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.213 | ||
| sheet | 0.272 | ||