Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145524.1 | 5prime_partial | 202 | 2-610(+) |
Amino Acid sequence : | |||
HERIHRFLQFHTMPSHQTPNSNKGLGIVIIGVSGSGKSTVAKTLAKSLGCSFFEADDFHSQANKEKMSKGIPLTDEDRTPWLETLRDAIRTKLDAGETVTVTCSALQKRYREILRSADPE YECGDYANCKLRFVCLEAPTELLASRISVRSENEKHFMPVSLLKSQLELLQIDRAEGIDMVDTRAGLQYSVDSILSLLTTDN* | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 22,574.396 | ||
Theoretical pI: | 6.097 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 41.239 | ||
aromaticity | 0.059 | ||
GRAVY | -0.363 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.213 | ||
sheet | 0.272 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145524.1 | 5prime_partial | 202 | 2-610(+) |
Amino Acid sequence : | |||
HERIHRFLQFHTMPSHQTPNSNKGLGIVIIGVSGSGKSTVAKTLAKSLGCSFFEADDFHSQANKEKMSKGIPLTDEDRTPWLETLRDAIRTKLDAGETVTVTCSALQKRYREILRSADPE YECGDYANCKLRFVCLEAPTELLASRISVRSENEKHFMPVSLLKSQLELLQIDRAEGIDMVDTRAGLQYSVDSILSLLTTDN* | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 22,574.396 | ||
Theoretical pI: | 6.097 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 41.239 | ||
aromaticity | 0.059 | ||
GRAVY | -0.363 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.213 | ||
sheet | 0.272 |