| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145543.1 | internal | 207 | 3-623(+) |
Amino Acid sequence : | |||
| GKSYPTVSAEYLKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTFDCKSKTGGPFGTMRHKAELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVEITGGPDVPFHPGRED KPEPPVEGRLPDATKGCDHLRTVFGEQMGLSDKDIVALSGGHTLGRCHKDRSGFEGAWTSNPLIFDNSYFTELLAGQKEGLLQLPSD | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 13,134.891 | ||
| Theoretical pI: | 9.834 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.519 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.538 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.252 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145543.1 | 3prime_partial | 115 | 347-3(-) |
Amino Acid sequence : | |||
| MERDIRASSNFHSNNTSKLIKISIGDDRELLLDRFQEPDGNIKTIVRSVSELRLMPHRPERTSGLRLTIESSGRVPCYSEHQRSTVLLGDKSTELPLALLHRLEVLRAHGRVRLP | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,134.891 | ||
| Theoretical pI: | 9.834 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.519 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.538 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.252 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145543.1 | internal | 207 | 3-623(+) |
Amino Acid sequence : | |||
| GKSYPTVSAEYLKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTFDCKSKTGGPFGTMRHKAELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVEITGGPDVPFHPGRED KPEPPVEGRLPDATKGCDHLRTVFGEQMGLSDKDIVALSGGHTLGRCHKDRSGFEGAWTSNPLIFDNSYFTELLAGQKEGLLQLPSD | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 13,134.891 | ||
| Theoretical pI: | 9.834 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.519 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.538 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.252 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145543.1 | 3prime_partial | 115 | 347-3(-) |
Amino Acid sequence : | |||
| MERDIRASSNFHSNNTSKLIKISIGDDRELLLDRFQEPDGNIKTIVRSVSELRLMPHRPERTSGLRLTIESSGRVPCYSEHQRSTVLLGDKSTELPLALLHRLEVLRAHGRVRLP | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,134.891 | ||
| Theoretical pI: | 9.834 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.519 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.538 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.252 | ||
| sheet | 0.270 | ||