| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145547.1 | 5prime_partial | 167 | 2-505(+) |
Amino Acid sequence : | |||
| FSPQKMAPIAVGDSIPDGTLAWFDENDELKQVSIHSLAAGKKVILFGVPGAFTPTCSMQHVPGFITSADELKSKGVDEILLVSVNDPFVMKAWAKTYPDNKHVKFLADGSGTYTHALGLE LDLSEKGLGTRSRRFALLADDLKVKVANIEEGGAFTISGADEILKAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 17,889.269 | ||
| Theoretical pI: | 5.325 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 34.012 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.011 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.234 | ||
| sheet | 0.281 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145547.1 | 5prime_partial | 167 | 2-505(+) |
Amino Acid sequence : | |||
| FSPQKMAPIAVGDSIPDGTLAWFDENDELKQVSIHSLAAGKKVILFGVPGAFTPTCSMQHVPGFITSADELKSKGVDEILLVSVNDPFVMKAWAKTYPDNKHVKFLADGSGTYTHALGLE LDLSEKGLGTRSRRFALLADDLKVKVANIEEGGAFTISGADEILKAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 17,889.269 | ||
| Theoretical pI: | 5.325 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 34.012 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.011 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.234 | ||
| sheet | 0.281 | ||