| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145586.1 | internal | 103 | 311-3(-) |
Amino Acid sequence : | |||
| IHCLFASDTFLSGSSKCIYDLAGYLRIDRFLWFDNFWGPFEALIETASPLEELIKVMFAVENSFKGIIVPQLESSFAVVASEACSVEYSVVGGELVHQVHGLV | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,716.389 | ||
| Theoretical pI: | 9.302 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 2.467 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.184 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145586.1 | internal | 103 | 3-311(+) |
Amino Acid sequence : | |||
| DKTVYLVDKLTADNRIFHRACFRCHHCKGTLKLGNYNSFEGVLYCKHHFDQLFKRTGSLDKSFEGTPKVVKPEKSVDPEVTSKVVNAFAGTREKCVGCKKTVY | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,716.389 | ||
| Theoretical pI: | 9.302 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 2.467 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.184 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145586.1 | internal | 103 | 311-3(-) |
Amino Acid sequence : | |||
| IHCLFASDTFLSGSSKCIYDLAGYLRIDRFLWFDNFWGPFEALIETASPLEELIKVMFAVENSFKGIIVPQLESSFAVVASEACSVEYSVVGGELVHQVHGLV | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,716.389 | ||
| Theoretical pI: | 9.302 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 2.467 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.184 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145586.1 | internal | 103 | 3-311(+) |
Amino Acid sequence : | |||
| DKTVYLVDKLTADNRIFHRACFRCHHCKGTLKLGNYNSFEGVLYCKHHFDQLFKRTGSLDKSFEGTPKVVKPEKSVDPEVTSKVVNAFAGTREKCVGCKKTVY | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,716.389 | ||
| Theoretical pI: | 9.302 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 2.467 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.184 | ||
| sheet | 0.155 | ||