| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145593.1 | internal | 138 | 2-415(+) |
Amino Acid sequence : | |||
| GERVVLNFMQRMSGIATLTKAMSDAARPACILETRKTAPGLRLVDKWAVLIGGGKNHRMGLFDMVMIKDNHISIAGGVTNAIKSVDQYLEHKSLQMSVEVETRTLEEVEEVLLYADQNKT YLTRIMLDNMVVPLQNGD | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,376.735 | ||
| Theoretical pI: | 6.347 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 39.369 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.188 | ||
| sheet | 0.312 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145593.1 | internal | 138 | 2-415(+) |
Amino Acid sequence : | |||
| GERVVLNFMQRMSGIATLTKAMSDAARPACILETRKTAPGLRLVDKWAVLIGGGKNHRMGLFDMVMIKDNHISIAGGVTNAIKSVDQYLEHKSLQMSVEVETRTLEEVEEVLLYADQNKT YLTRIMLDNMVVPLQNGD | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,376.735 | ||
| Theoretical pI: | 6.347 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 39.369 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.188 | ||
| sheet | 0.312 | ||