| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145597.1 | internal | 100 | 2-301(+) |
Amino Acid sequence : | |||
| ETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVELPLANLLYSFNWELPAGIFKD | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,446.032 | ||
| Theoretical pI: | 5.619 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 36.372 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.168 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.270 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145597.1 | internal | 100 | 2-301(+) |
Amino Acid sequence : | |||
| ETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVELPLANLLYSFNWELPAGIFKD | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,446.032 | ||
| Theoretical pI: | 5.619 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 36.372 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.168 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.270 | ||
| sheet | 0.230 | ||