Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145600.1 | internal | 149 | 2-448(+) |
Amino Acid sequence : | |||
TFSCSILGSNKAAIEISDEDEVSITPLDEPLGVECNAACVDKELSNLAQWLGGTYTGTPDSFDGKLSLPSSDDFFFSLDMSKKSDRHFALSLVVLVKNIKKAVEFHEDFAGDSVGTAELL IGHFTGIEALVEEYGSGDTADQGIALLET | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 15,898.470 | ||
Theoretical pI: | 4.151 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 36.444 | ||
aromaticity | 0.081 | ||
GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.248 | ||
sheet | 0.289 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145600.1 | internal | 149 | 2-448(+) |
Amino Acid sequence : | |||
TFSCSILGSNKAAIEISDEDEVSITPLDEPLGVECNAACVDKELSNLAQWLGGTYTGTPDSFDGKLSLPSSDDFFFSLDMSKKSDRHFALSLVVLVKNIKKAVEFHEDFAGDSVGTAELL IGHFTGIEALVEEYGSGDTADQGIALLET | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 15,898.470 | ||
Theoretical pI: | 4.151 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 36.444 | ||
aromaticity | 0.081 | ||
GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.248 | ||
sheet | 0.289 |