Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145611.1 | internal | 166 | 500-3(-) |
Amino Acid sequence : | |||
QDDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQS MRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDEEGSNTREPNP | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 17,401.315 | ||
Theoretical pI: | 5.850 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 52.648 | ||
aromaticity | 0.092 | ||
GRAVY | -0.738 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.243 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145611.1 | 5prime_partial | 152 | 1-459(+) |
Amino Acid sequence : | |||
FGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVE EVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 17,401.315 | ||
Theoretical pI: | 5.850 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 52.648 | ||
aromaticity | 0.092 | ||
GRAVY | -0.738 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.243 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145611.1 | internal | 166 | 500-3(-) |
Amino Acid sequence : | |||
QDDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQS MRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDEEGSNTREPNP | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 17,401.315 | ||
Theoretical pI: | 5.850 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 52.648 | ||
aromaticity | 0.092 | ||
GRAVY | -0.738 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.243 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145611.1 | 5prime_partial | 152 | 1-459(+) |
Amino Acid sequence : | |||
FGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVE EVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 17,401.315 | ||
Theoretical pI: | 5.850 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 52.648 | ||
aromaticity | 0.092 | ||
GRAVY | -0.738 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.243 | ||
sheet | 0.224 |