Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145636.1 | 5prime_partial | 134 | 2-406(+) |
Amino Acid sequence : | |||
HEIEAMTCGLPMFATAYGGPAEIIVDGVSGYHIDPYQGDKAAELLVDFFDKCKDDPTHWDKFSEQGLKRIEEKYTWKLYSERLMTLAGVYGFWKFVSKLDRRETRRYLEMFYALKYRNLA NSVPLAVDGEDDAK* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 15,504.422 | ||
Theoretical pI: | 5.207 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
Instability index: | 36.625 | ||
aromaticity | 0.142 | ||
GRAVY | -0.475 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.164 | ||
sheet | 0.284 |