| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145647.1 | internal | 236 | 3-710(+) |
Amino Acid sequence : | |||
| DPPGCRNSAPGTTTSKVLLTGQDCDHKRRLNEGSPRDIMAEVSKTHEAIQSLDKTVSTLEMELAVARTNRIDHPDSNGESGKGLQKAFVVIGINTAFSSKKRRESLRETWVPRGPKLKRL EEEKGIVIRFVIGHSATPGGVLDRAIDAENAESKDFLRLEHVEGYHELSMKTKLYFSTALSIWDAHFYVKVDDDVHVNLGMLTTTLARHKTEPRIYIGCMKSGPVLYHKEVKYHEP | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 26,446.779 | ||
| Theoretical pI: | 8.377 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 36.864 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.555 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.220 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145647.1 | internal | 236 | 3-710(+) |
Amino Acid sequence : | |||
| DPPGCRNSAPGTTTSKVLLTGQDCDHKRRLNEGSPRDIMAEVSKTHEAIQSLDKTVSTLEMELAVARTNRIDHPDSNGESGKGLQKAFVVIGINTAFSSKKRRESLRETWVPRGPKLKRL EEEKGIVIRFVIGHSATPGGVLDRAIDAENAESKDFLRLEHVEGYHELSMKTKLYFSTALSIWDAHFYVKVDDDVHVNLGMLTTTLARHKTEPRIYIGCMKSGPVLYHKEVKYHEP | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 26,446.779 | ||
| Theoretical pI: | 8.377 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 36.864 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.555 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.220 | ||
| sheet | 0.246 | ||