| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145659.1 | internal | 134 | 1-402(+) |
Amino Acid sequence : | |||
| KVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKE LAGISPGLVRMSVG | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,725.222 | ||
| Theoretical pI: | 10.351 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 62.823 | ||
| aromaticity | 0.015 | ||
| GRAVY | -1.230 | ||
Secondary Structure Fraction | |||
| Helix | 0.165 | ||
| turn | 0.331 | ||
| sheet | 0.180 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145659.1 | internal | 133 | 3-401(+) |
Amino Acid sequence : | |||
| GGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQGA CRHLPRTSQDVCR | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,725.222 | ||
| Theoretical pI: | 10.351 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 62.823 | ||
| aromaticity | 0.015 | ||
| GRAVY | -1.230 | ||
Secondary Structure Fraction | |||
| Helix | 0.165 | ||
| turn | 0.331 | ||
| sheet | 0.180 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145659.1 | internal | 134 | 1-402(+) |
Amino Acid sequence : | |||
| KVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKE LAGISPGLVRMSVG | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,725.222 | ||
| Theoretical pI: | 10.351 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 62.823 | ||
| aromaticity | 0.015 | ||
| GRAVY | -1.230 | ||
Secondary Structure Fraction | |||
| Helix | 0.165 | ||
| turn | 0.331 | ||
| sheet | 0.180 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145659.1 | internal | 133 | 3-401(+) |
Amino Acid sequence : | |||
| GGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQGA CRHLPRTSQDVCR | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,725.222 | ||
| Theoretical pI: | 10.351 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 62.823 | ||
| aromaticity | 0.015 | ||
| GRAVY | -1.230 | ||
Secondary Structure Fraction | |||
| Helix | 0.165 | ||
| turn | 0.331 | ||
| sheet | 0.180 | ||