| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145683.1 | internal | 210 | 2-631(+) |
Amino Acid sequence : | |||
| HETKIWRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGV AIIDVNVAPPDSGFTESDITCTAEELVKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLIDIPSPEVPAADGNQVEQTLL | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 22,744.052 | ||
| Theoretical pI: | 4.368 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 36.461 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.305 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145683.1 | internal | 210 | 2-631(+) |
Amino Acid sequence : | |||
| HETKIWRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGV AIIDVNVAPPDSGFTESDITCTAEELVKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLIDIPSPEVPAADGNQVEQTLL | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 22,744.052 | ||
| Theoretical pI: | 4.368 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 36.461 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.305 | ||
| sheet | 0.219 | ||