| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145688.1 | internal | 129 | 387-1(-) |
Amino Acid sequence : | |||
| HTTHKRGNNQPQDDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSAL NTCASGVSF | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 10,147.193 | ||
| Theoretical pI: | 4.413 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 57.281 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.602 | ||
Secondary Structure Fraction | |||
| Helix | 0.081 | ||
| turn | 0.404 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145688.1 | 5prime_partial | 103 | 2-313(+) |
Amino Acid sequence : | |||
| KETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,147.193 | ||
| Theoretical pI: | 4.413 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 57.281 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.602 | ||
Secondary Structure Fraction | |||
| Helix | 0.081 | ||
| turn | 0.404 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145688.1 | 5prime_partial | 99 | 1-300(+) |
Amino Acid sequence : | |||
| EGDAGGARVQGRPPRNQEGGGEGGSGGGEDPPDQRGEEEGAGGEERHVAPRGEEQREVSEEVPDAGEREGGGGEGFDGERSSYRYRAEGGGQEAGSQIH* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,147.193 | ||
| Theoretical pI: | 4.413 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 57.281 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.602 | ||
Secondary Structure Fraction | |||
| Helix | 0.081 | ||
| turn | 0.404 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145688.1 | internal | 129 | 387-1(-) |
Amino Acid sequence : | |||
| HTTHKRGNNQPQDDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSAL NTCASGVSF | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 10,147.193 | ||
| Theoretical pI: | 4.413 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 57.281 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.602 | ||
Secondary Structure Fraction | |||
| Helix | 0.081 | ||
| turn | 0.404 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145688.1 | 5prime_partial | 103 | 2-313(+) |
Amino Acid sequence : | |||
| KETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,147.193 | ||
| Theoretical pI: | 4.413 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 57.281 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.602 | ||
Secondary Structure Fraction | |||
| Helix | 0.081 | ||
| turn | 0.404 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145688.1 | 5prime_partial | 99 | 1-300(+) |
Amino Acid sequence : | |||
| EGDAGGARVQGRPPRNQEGGGEGGSGGGEDPPDQRGEEEGAGGEERHVAPRGEEQREVSEEVPDAGEREGGGGEGFDGERSSYRYRAEGGGQEAGSQIH* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,147.193 | ||
| Theoretical pI: | 4.413 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 57.281 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.602 | ||
Secondary Structure Fraction | |||
| Helix | 0.081 | ||
| turn | 0.404 | ||
| sheet | 0.273 | ||