| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145691.1 | 5prime_partial | 126 | 2-382(+) |
Amino Acid sequence : | |||
| HEAMPENNMVGKAIRDPERLKVIASNPRRYTGRPRVGTMREIARMCEHVQGSFQRVTAPFLALHGTDDGVTSPEGSKMLYEKAASEDKELVLYEGMLHSLVQGEPEENSRRVLADMRAWI DKRVEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 14,306.170 | ||
| Theoretical pI: | 7.107 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 35.625 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.700 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.214 | ||
| sheet | 0.317 | ||