Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145691.1 | 5prime_partial | 126 | 2-382(+) |
Amino Acid sequence : | |||
HEAMPENNMVGKAIRDPERLKVIASNPRRYTGRPRVGTMREIARMCEHVQGSFQRVTAPFLALHGTDDGVTSPEGSKMLYEKAASEDKELVLYEGMLHSLVQGEPEENSRRVLADMRAWI DKRVEK* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 14,306.170 | ||
Theoretical pI: | 7.107 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 35.625 | ||
aromaticity | 0.048 | ||
GRAVY | -0.700 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.214 | ||
sheet | 0.317 |