| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145693.1 | internal | 130 | 1-390(+) |
Amino Acid sequence : | |||
| DRIGGLMMYGVPNMKTDKTDIVQRRVNLMAEEGIKFVVNANVGKDPVYSLDSLRAGNDAIILACGATKPRDLPVPGREMSGVHFAMEFLHANTKSLLDSNLEDGKYISAKGKKVVVIGGG DTGTDCIGTS | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 13,855.788 | ||
| Theoretical pI: | 6.923 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 28.433 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.152 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.269 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145693.1 | internal | 130 | 1-390(+) |
Amino Acid sequence : | |||
| DRIGGLMMYGVPNMKTDKTDIVQRRVNLMAEEGIKFVVNANVGKDPVYSLDSLRAGNDAIILACGATKPRDLPVPGREMSGVHFAMEFLHANTKSLLDSNLEDGKYISAKGKKVVVIGGG DTGTDCIGTS | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 13,855.788 | ||
| Theoretical pI: | 6.923 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 28.433 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.152 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.269 | ||
| sheet | 0.231 | ||