Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145704.1 | internal | 191 | 1-573(+) |
Amino Acid sequence : | |||
ARGAICGPASLVNSMMDLHQGALMLLGPTMNAKVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTE FGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVGYSGTIDQRWGQFEKAISRMQVDVHA | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 18,254.136 | ||
Theoretical pI: | 10.204 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 62.982 | ||
aromaticity | 0.012 | ||
GRAVY | -1.247 | ||
Secondary Structure Fraction | |||
Helix | 0.157 | ||
turn | 0.349 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145704.1 | 5prime_partial | 166 | 3-503(+) |
Amino Acid sequence : | |||
TRSNLRTGKPGKLDDGPPPRSPNALGPHHECQGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGV WAHGRLSRVLRDPHVVFREQHQQRVEHSGQGACRHLPRTSQDVCRL* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,254.136 | ||
Theoretical pI: | 10.204 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 62.982 | ||
aromaticity | 0.012 | ||
GRAVY | -1.247 | ||
Secondary Structure Fraction | |||
Helix | 0.157 | ||
turn | 0.349 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145704.1 | internal | 191 | 1-573(+) |
Amino Acid sequence : | |||
ARGAICGPASLVNSMMDLHQGALMLLGPTMNAKVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTE FGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVGYSGTIDQRWGQFEKAISRMQVDVHA | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 18,254.136 | ||
Theoretical pI: | 10.204 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 62.982 | ||
aromaticity | 0.012 | ||
GRAVY | -1.247 | ||
Secondary Structure Fraction | |||
Helix | 0.157 | ||
turn | 0.349 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145704.1 | 5prime_partial | 166 | 3-503(+) |
Amino Acid sequence : | |||
TRSNLRTGKPGKLDDGPPPRSPNALGPHHECQGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGV WAHGRLSRVLRDPHVVFREQHQQRVEHSGQGACRHLPRTSQDVCRL* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,254.136 | ||
Theoretical pI: | 10.204 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 62.982 | ||
aromaticity | 0.012 | ||
GRAVY | -1.247 | ||
Secondary Structure Fraction | |||
Helix | 0.157 | ||
turn | 0.349 | ||
sheet | 0.181 |