| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145705.1 | internal | 152 | 3-458(+) |
Amino Acid sequence : | |||
| GDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDVNVAPPDSGFTESDITCTAEEL VKSVEEHPSQVVVGDLLDASNDALPHPQPTLA | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,320.826 | ||
| Theoretical pI: | 4.320 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 38.850 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.345 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.322 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145705.1 | internal | 152 | 3-458(+) |
Amino Acid sequence : | |||
| GDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDVNVAPPDSGFTESDITCTAEEL VKSVEEHPSQVVVGDLLDASNDALPHPQPTLA | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,320.826 | ||
| Theoretical pI: | 4.320 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 38.850 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.345 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.322 | ||
| sheet | 0.217 | ||