| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145707.1 | 5prime_partial | 176 | 1-531(+) |
Amino Acid sequence : | |||
| GGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLNRVTVPFLVLHGTSDTV TDPEATQRLYQEASSTDKSIKLYEGFLHDLLFEPERDDIARSIIDWLRSRVDRCSM* | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 19,708.418 | ||
| Theoretical pI: | 7.951 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 41.568 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.144 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.227 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145707.1 | 5prime_partial | 176 | 1-531(+) |
Amino Acid sequence : | |||
| GGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLNRVTVPFLVLHGTSDTV TDPEATQRLYQEASSTDKSIKLYEGFLHDLLFEPERDDIARSIIDWLRSRVDRCSM* | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 19,708.418 | ||
| Theoretical pI: | 7.951 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 41.568 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.144 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.227 | ||
| sheet | 0.239 | ||