Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145708.1 | 5prime_partial | 106 | 1-321(+) |
Amino Acid sequence : | |||
AMGGRLSYIFVSMLLLSASLCLAQQEEDPENKRCKAALNQGAPRCFDDLYENETLPTGVVCCKNYLDMDSTSPTCWDRLFEDPSSAKNLEDALTKCKSIIKTSALE* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,733.266 | ||
Theoretical pI: | 4.683 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
Instability index: | 43.376 | ||
aromaticity | 0.066 | ||
GRAVY | -0.272 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.226 | ||
sheet | 0.321 |