| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145719.1 | internal | 178 | 1-534(+) |
Amino Acid sequence : | |||
| PRIQSQQQFPCNQLTTDFVGRSSLLPPPRSRRWSSEGVNTEETSPSHHSQRRRASYPPNIWDDSYIQALQIGYMENEQVSEIKKLKEDVVQLIGDTKEIKYQIKLIDELQQLGVAYHFQD EIKDTLSIIFCSLEKTSSVMENDLKATSLIFRLLREHGLHVSADIFNNFIDEGGNFEP | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 20,525.767 | ||
| Theoretical pI: | 5.241 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 60.284 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.606 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.242 | ||
| sheet | 0.213 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145719.1 | internal | 178 | 1-534(+) |
Amino Acid sequence : | |||
| PRIQSQQQFPCNQLTTDFVGRSSLLPPPRSRRWSSEGVNTEETSPSHHSQRRRASYPPNIWDDSYIQALQIGYMENEQVSEIKKLKEDVVQLIGDTKEIKYQIKLIDELQQLGVAYHFQD EIKDTLSIIFCSLEKTSSVMENDLKATSLIFRLLREHGLHVSADIFNNFIDEGGNFEP | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 20,525.767 | ||
| Theoretical pI: | 5.241 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 60.284 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.606 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.242 | ||
| sheet | 0.213 | ||