| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145726.1 | internal | 136 | 3-410(+) |
Amino Acid sequence : | |||
| VSEIKKLKEDVVQLIGDTKEIKYQIKLIDELQQLGVAYHFQDEIKDTLSIIFCSLEKTSSVMENDLKATSLIFRLLREHGLHVSADIFNNFIDEGGNFEPCLKNDTEGMLSLYEASFLGM EGEKQLDEARRFATEH | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 15,557.492 | ||
| Theoretical pI: | 4.737 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 21.809 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.295 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.169 | ||
| sheet | 0.309 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145726.1 | internal | 136 | 3-410(+) |
Amino Acid sequence : | |||
| VSEIKKLKEDVVQLIGDTKEIKYQIKLIDELQQLGVAYHFQDEIKDTLSIIFCSLEKTSSVMENDLKATSLIFRLLREHGLHVSADIFNNFIDEGGNFEPCLKNDTEGMLSLYEASFLGM EGEKQLDEARRFATEH | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 15,557.492 | ||
| Theoretical pI: | 4.737 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 21.809 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.295 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.169 | ||
| sheet | 0.309 | ||