| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145728.1 | 5prime_partial | 141 | 2-427(+) |
Amino Acid sequence : | |||
| DLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKAIEEAPKFVKNGDACFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVI KSVEKKDPTGAKVTKAAAKKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 11,949.726 | ||
| Theoretical pI: | 10.797 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 31.554 | ||
| aromaticity | 0.119 | ||
| GRAVY | 0.372 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.248 | ||
| sheet | 0.266 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145728.1 | complete | 109 | 444-115(-) |
Amino Acid sequence : | |||
| MEIRTRHFFLAAALVTLAPVGSFFSTLLITPTATVWRMSLTANRPRGGYSEKVSTTMGLVGIIFTKQASPFFTNFGASSIALPDRLSILVRISENFTAMWEVWQSSTGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,949.726 | ||
| Theoretical pI: | 10.797 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 31.554 | ||
| aromaticity | 0.119 | ||
| GRAVY | 0.372 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.248 | ||
| sheet | 0.266 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145728.1 | 5prime_partial | 141 | 2-427(+) |
Amino Acid sequence : | |||
| DLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKAIEEAPKFVKNGDACFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVI KSVEKKDPTGAKVTKAAAKKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 11,949.726 | ||
| Theoretical pI: | 10.797 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 31.554 | ||
| aromaticity | 0.119 | ||
| GRAVY | 0.372 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.248 | ||
| sheet | 0.266 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145728.1 | complete | 109 | 444-115(-) |
Amino Acid sequence : | |||
| MEIRTRHFFLAAALVTLAPVGSFFSTLLITPTATVWRMSLTANRPRGGYSEKVSTTMGLVGIIFTKQASPFFTNFGASSIALPDRLSILVRISENFTAMWEVWQSSTGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,949.726 | ||
| Theoretical pI: | 10.797 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 31.554 | ||
| aromaticity | 0.119 | ||
| GRAVY | 0.372 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.248 | ||
| sheet | 0.266 | ||