| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145741.1 | 3prime_partial | 191 | 50-622(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVS | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 19,984.850 | ||
| Theoretical pI: | 8.171 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 26.209 | ||
| aromaticity | 0.047 | ||
| GRAVY | 0.232 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.262 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145741.1 | 3prime_partial | 191 | 50-622(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVS | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 19,984.850 | ||
| Theoretical pI: | 8.171 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 26.209 | ||
| aromaticity | 0.047 | ||
| GRAVY | 0.232 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.262 | ||
| sheet | 0.230 | ||