Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145761.1 | internal | 132 | 1-396(+) |
Amino Acid sequence : | |||
RLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAVNTKQSMFYGTSTRGWKLLDPYFVFMNPRPTYEITFLNQLPKELTCAGGKSPIEVANYIQRVLGGTLGFECTNFTRKDKY ALLAGTDGVVRN | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,833.970 | ||
Theoretical pI: | 7.826 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
Instability index: | 41.501 | ||
aromaticity | 0.114 | ||
GRAVY | -0.065 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.220 | ||
sheet | 0.258 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145761.1 | internal | 132 | 1-396(+) |
Amino Acid sequence : | |||
RLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAVNTKQSMFYGTSTRGWKLLDPYFVFMNPRPTYEITFLNQLPKELTCAGGKSPIEVANYIQRVLGGTLGFECTNFTRKDKY ALLAGTDGVVRN | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,833.970 | ||
Theoretical pI: | 7.826 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
Instability index: | 41.501 | ||
aromaticity | 0.114 | ||
GRAVY | -0.065 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.220 | ||
sheet | 0.258 |