| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145764.1 | 5prime_partial | 151 | 1-456(+) |
Amino Acid sequence : | |||
| LTAENVESVLDEVRPYLMADGGNVALHEIDGNVVRLKLQGACGSCPSSVMTMKMGIQSRLMEKIPEIVAVEPITDEETGLELNKENIEKVLDEIRPYLVGTGGGELEFVAIEEPIVKVRL SGPAAGVMTVRVALTQKLREKIPSIAAVQLL* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,293.818 | ||
| Theoretical pI: | 4.736 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 48.326 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.130 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.219 | ||
| sheet | 0.344 | ||