Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145771.1 | 3prime_partial | 185 | 31-585(+) |
Amino Acid sequence : | |||
MAPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKLEGNLPLFGFHDPASFVNSIQKPRVIIMLVKAGAPVDQTIDTLSVYLEKGDCIIDGGNEWYENTERREKAMAE RGFLYLGMGVSGGEEGARNGPSMMPGGSFEAYKYIEDILLKVAAQVSDSGPCVTYIGKGGSGNFV | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 19,843.445 | ||
Theoretical pI: | 5.118 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 21.854 | ||
aromaticity | 0.081 | ||
GRAVY | -0.098 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.286 | ||
sheet | 0.270 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145771.1 | 3prime_partial | 185 | 31-585(+) |
Amino Acid sequence : | |||
MAPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKLEGNLPLFGFHDPASFVNSIQKPRVIIMLVKAGAPVDQTIDTLSVYLEKGDCIIDGGNEWYENTERREKAMAE RGFLYLGMGVSGGEEGARNGPSMMPGGSFEAYKYIEDILLKVAAQVSDSGPCVTYIGKGGSGNFV | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 19,843.445 | ||
Theoretical pI: | 5.118 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 21.854 | ||
aromaticity | 0.081 | ||
GRAVY | -0.098 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.286 | ||
sheet | 0.270 |