| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145773.1 | internal | 140 | 1-420(+) |
Amino Acid sequence : | |||
| TDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLNR VTVPFLVLHGTSDTVTDPEA | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,209.391 | ||
| Theoretical pI: | 8.616 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 38.941 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.051 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.271 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145773.1 | internal | 140 | 1-420(+) |
Amino Acid sequence : | |||
| TDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLNR VTVPFLVLHGTSDTVTDPEA | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,209.391 | ||
| Theoretical pI: | 8.616 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 38.941 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.051 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.271 | ||
| sheet | 0.221 | ||