Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145799.1 | 5prime_partial | 107 | 2-325(+) |
Amino Acid sequence : | |||
HEMEYSLMSRKAIMVLLLLGAAGMFFAKRADAACGMNKEELFSCKPSVSGSNPPKPSEACCSALATADLPCFCKHRNSLMVRLLGIDFDLAMQLPKKCGIPQPRPHC* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 10,917.530 | ||
Theoretical pI: | 9.567 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 84.762 | ||
aromaticity | 0.070 | ||
GRAVY | -0.195 | ||
Secondary Structure Fraction | |||
Helix | 0.210 | ||
turn | 0.290 | ||
sheet | 0.340 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145799.1 | 3prime_partial | 100 | 300-1(-) |
Amino Acid sequence : | |||
MPHFLGSCMARSKSMPSRRTISEFRCLQKHGRSAVANAEQHASEGFGGFEPLTEGLHEKSSSLFMPQAASALLAKNIPAAPRSKSTMMAFLLIREYSISC | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,917.530 | ||
Theoretical pI: | 9.567 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 84.762 | ||
aromaticity | 0.070 | ||
GRAVY | -0.195 | ||
Secondary Structure Fraction | |||
Helix | 0.210 | ||
turn | 0.290 | ||
sheet | 0.340 |