Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145803.1 | complete | 163 | 37-528(+) |
Amino Acid sequence : | |||
MSLIRGQRSNVFDPFSLDIWDPLQGLGLGFPFGRSVADTNRGQQQSGDETSAFAIARVDWKETPEAHVFKADLPGLKKEEVKVEVEEGRVLQISGERSREKEEKNDTWHRVERSIGKFLR RFRLPENAKMEEVKATMENGVLMVTVPKEEVKKPEVKSIQISG* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 18,523.808 | ||
Theoretical pI: | 6.209 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 50.077 | ||
aromaticity | 0.067 | ||
GRAVY | -0.690 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.227 | ||
sheet | 0.264 |