| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145810.1 | internal | 131 | 1-393(+) |
Amino Acid sequence : | |||
| LTPSISQPFLHRSRIGAISRFSSDHGSLEFDMSNEENKRQLHNRLLYRSRQRGLLELDLVLGNWVAENIRSMDKHRIKALVDVLDLENPDLWSWLTGQEQPPEAVNNNPVFAAVRSKVAE NLNHAAPETRA | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,962.642 | ||
| Theoretical pI: | 6.575 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 58.289 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.582 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.267 | ||
| sheet | 0.298 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145810.1 | internal | 131 | 1-393(+) |
Amino Acid sequence : | |||
| LTPSISQPFLHRSRIGAISRFSSDHGSLEFDMSNEENKRQLHNRLLYRSRQRGLLELDLVLGNWVAENIRSMDKHRIKALVDVLDLENPDLWSWLTGQEQPPEAVNNNPVFAAVRSKVAE NLNHAAPETRA | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,962.642 | ||
| Theoretical pI: | 6.575 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 58.289 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.582 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.267 | ||
| sheet | 0.298 | ||