| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145817.1 | internal | 189 | 3-569(+) |
Amino Acid sequence : | |||
| SMTVRSENWSELNYESGFGNHVSSESLPGALPRDQNSPLICPFGLYAEQISGTSFTAPRKINQRSWLYRIKPSVTHEPFYPLVPGHKHLVSEFNQSTSSATPTQLRWRPADVPVSPTDFI DGLYTVCGAGSSFLRYGYAIHMYTANKSMEGCAFCNADGDFLIVPQEGRLWITTECGRLQVSPGEVVVI | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 14,903.421 | ||
| Theoretical pI: | 9.025 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 56.859 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.371 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.355 | ||
| sheet | 0.167 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145817.1 | 5prime_partial | 138 | 569-153(-) |
Amino Acid sequence : | |||
| NNNYFTRRDLQSSTFSCNPQSSFLGNNQKITISIAEGTTFHGFVSSVHVNGVSVTEERTPCSAHRVEPINEIGGGNGNISRPPAQLCRSSRTRGLVKLTNKVLVAGDQRVEGLVSNRWFY AIQPAPLVDLSWGGEGGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 14,903.421 | ||
| Theoretical pI: | 9.025 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 56.859 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.371 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.355 | ||
| sheet | 0.167 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145817.1 | internal | 189 | 3-569(+) |
Amino Acid sequence : | |||
| SMTVRSENWSELNYESGFGNHVSSESLPGALPRDQNSPLICPFGLYAEQISGTSFTAPRKINQRSWLYRIKPSVTHEPFYPLVPGHKHLVSEFNQSTSSATPTQLRWRPADVPVSPTDFI DGLYTVCGAGSSFLRYGYAIHMYTANKSMEGCAFCNADGDFLIVPQEGRLWITTECGRLQVSPGEVVVI | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 14,903.421 | ||
| Theoretical pI: | 9.025 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 56.859 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.371 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.355 | ||
| sheet | 0.167 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145817.1 | 5prime_partial | 138 | 569-153(-) |
Amino Acid sequence : | |||
| NNNYFTRRDLQSSTFSCNPQSSFLGNNQKITISIAEGTTFHGFVSSVHVNGVSVTEERTPCSAHRVEPINEIGGGNGNISRPPAQLCRSSRTRGLVKLTNKVLVAGDQRVEGLVSNRWFY AIQPAPLVDLSWGGEGGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 14,903.421 | ||
| Theoretical pI: | 9.025 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 56.859 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.371 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.355 | ||
| sheet | 0.167 | ||