Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145829.1 | internal | 189 | 2-568(+) |
Amino Acid sequence : | |||
IPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIG PFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSP | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 19,734.578 | ||
Theoretical pI: | 8.500 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 27.687 | ||
aromaticity | 0.048 | ||
GRAVY | 0.239 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.265 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145829.1 | internal | 189 | 2-568(+) |
Amino Acid sequence : | |||
IPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIG PFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSP | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 19,734.578 | ||
Theoretical pI: | 8.500 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 27.687 | ||
aromaticity | 0.048 | ||
GRAVY | 0.239 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.265 | ||
sheet | 0.222 |