| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145829.1 | internal | 189 | 2-568(+) |
Amino Acid sequence : | |||
| IPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIG PFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSP | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 19,734.578 | ||
| Theoretical pI: | 8.500 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 27.687 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.239 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.265 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145829.1 | internal | 189 | 2-568(+) |
Amino Acid sequence : | |||
| IPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIG PFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSP | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 19,734.578 | ||
| Theoretical pI: | 8.500 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 27.687 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.239 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.265 | ||
| sheet | 0.222 | ||