| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145876.1 | internal | 133 | 401-3(-) |
Amino Acid sequence : | |||
| PRMRCFKQKPPYVHGYLHMEDSFGFHLGYKLKLCIEKSMIFEVDVYKVPLTGGLKIGHLILFFSPCRSLLDHRPTLRTQLRNFLWVLTTNVEHGTIFERDRRNIIDTFSHHMFHGSHKDY KTPTLYRQASNAR | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 15,791.196 | ||
| Theoretical pI: | 9.754 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 28.711 | ||
| aromaticity | 0.128 | ||
| GRAVY | -0.408 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.195 | ||
| sheet | 0.195 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145876.1 | internal | 133 | 401-3(-) |
Amino Acid sequence : | |||
| PRMRCFKQKPPYVHGYLHMEDSFGFHLGYKLKLCIEKSMIFEVDVYKVPLTGGLKIGHLILFFSPCRSLLDHRPTLRTQLRNFLWVLTTNVEHGTIFERDRRNIIDTFSHHMFHGSHKDY KTPTLYRQASNAR | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 15,791.196 | ||
| Theoretical pI: | 9.754 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 28.711 | ||
| aromaticity | 0.128 | ||
| GRAVY | -0.408 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.195 | ||
| sheet | 0.195 | ||