Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145884.1 | 5prime_partial | 170 | 3-515(+) |
Amino Acid sequence : | |||
LQEFGTRNAKVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLRSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTS SELSTQDKELAGISPGLVRMSVGYSGTIDQRWGQFEKAISRMQVDVHAKN* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 15,933.570 | ||
Theoretical pI: | 9.213 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 64.327 | ||
aromaticity | 0.014 | ||
GRAVY | -1.165 | ||
Secondary Structure Fraction | |||
Helix | 0.167 | ||
turn | 0.313 | ||
sheet | 0.201 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145884.1 | 5prime_partial | 144 | 2-436(+) |
Amino Acid sequence : | |||
AAGIRHEECQGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQ QRVEHSGQGACRHLPRTSQDVCRL* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 15,933.570 | ||
Theoretical pI: | 9.213 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 64.327 | ||
aromaticity | 0.014 | ||
GRAVY | -1.165 | ||
Secondary Structure Fraction | |||
Helix | 0.167 | ||
turn | 0.313 | ||
sheet | 0.201 |