| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145893.1 | internal | 168 | 2-505(+) |
Amino Acid sequence : | |||
| KTKSLEMDFRVMGLDAPMLSALHHLMEDVSGSDSSLEKEKATGPTRSYVRDATAMAYTPLDIKELPESYVFLVDMPGVKSGEIRVQVEDDNLLVITGERKREDDRDQHHKYLRMERRMGK FMRKFSLPENVDTENGISAICQDGVLTVTVQKKPPPEPKKPKTIEVKI | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,590.106 | ||
| Theoretical pI: | 5.814 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 43.632 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.021 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.190 | ||
| sheet | 0.304 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145893.1 | internal | 168 | 505-2(-) |
Amino Acid sequence : | |||
| DLDLDGLGLLGLRRRLLLDRHGEDTVLANCGNAILGVDILRKRELPHELPHPPLHPQILVVLIPVVLALPLSGDDEEVVVLHLDPDLAGLDTWHVHEEDVRLGELLDVERGVGHGGRVAD VATGRAGRLLLLQRRIGTGHVLHQVVEGRQHRSIQSHHSEIHFQTLCF | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,590.106 | ||
| Theoretical pI: | 5.814 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 43.632 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.021 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.190 | ||
| sheet | 0.304 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145893.1 | internal | 168 | 2-505(+) |
Amino Acid sequence : | |||
| KTKSLEMDFRVMGLDAPMLSALHHLMEDVSGSDSSLEKEKATGPTRSYVRDATAMAYTPLDIKELPESYVFLVDMPGVKSGEIRVQVEDDNLLVITGERKREDDRDQHHKYLRMERRMGK FMRKFSLPENVDTENGISAICQDGVLTVTVQKKPPPEPKKPKTIEVKI | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,590.106 | ||
| Theoretical pI: | 5.814 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 43.632 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.021 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.190 | ||
| sheet | 0.304 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145893.1 | internal | 168 | 505-2(-) |
Amino Acid sequence : | |||
| DLDLDGLGLLGLRRRLLLDRHGEDTVLANCGNAILGVDILRKRELPHELPHPPLHPQILVVLIPVVLALPLSGDDEEVVVLHLDPDLAGLDTWHVHEEDVRLGELLDVERGVGHGGRVAD VATGRAGRLLLLQRRIGTGHVLHQVVEGRQHRSIQSHHSEIHFQTLCF | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,590.106 | ||
| Theoretical pI: | 5.814 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 43.632 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.021 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.190 | ||
| sheet | 0.304 | ||