| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145900.1 | internal | 170 | 1-510(+) |
Amino Acid sequence : | |||
| AKLSNVCLVIHNPGVEEDPACGPLIDSVAIKTLYPPKHTNTNLLKNGDFEEGPYILPNTSWGVLIPPNIEDDHSPLPGWIIESLKAIKYIDAPHFSIPKGRRAVELVAGKESALAQIVRT IPGKIYTLAFAVGDAANSCEGSMIVEAYAARANVKVPYASKGSGGFKRGV | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 12,103.348 | ||
| Theoretical pI: | 9.102 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 44.761 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.586 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.245 | ||
| sheet | 0.179 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145900.1 | 5prime_partial | 106 | 510-190(-) |
Amino Acid sequence : | |||
| HSALKPSRALRCVWNLHIRSRRISFDDHRPFARVGRISDRKGQRVDLAGNRADNLSEGALFAGNEFDGTPSFGDGEVRSVDVFDGLEGFDYPARKWRVIVFDVRWD* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,103.348 | ||
| Theoretical pI: | 9.102 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 44.761 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.586 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.245 | ||
| sheet | 0.179 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145900.1 | internal | 170 | 1-510(+) |
Amino Acid sequence : | |||
| AKLSNVCLVIHNPGVEEDPACGPLIDSVAIKTLYPPKHTNTNLLKNGDFEEGPYILPNTSWGVLIPPNIEDDHSPLPGWIIESLKAIKYIDAPHFSIPKGRRAVELVAGKESALAQIVRT IPGKIYTLAFAVGDAANSCEGSMIVEAYAARANVKVPYASKGSGGFKRGV | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 12,103.348 | ||
| Theoretical pI: | 9.102 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 44.761 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.586 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.245 | ||
| sheet | 0.179 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145900.1 | 5prime_partial | 106 | 510-190(-) |
Amino Acid sequence : | |||
| HSALKPSRALRCVWNLHIRSRRISFDDHRPFARVGRISDRKGQRVDLAGNRADNLSEGALFAGNEFDGTPSFGDGEVRSVDVFDGLEGFDYPARKWRVIVFDVRWD* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,103.348 | ||
| Theoretical pI: | 9.102 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 44.761 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.586 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.245 | ||
| sheet | 0.179 | ||