| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145901.1 | 5prime_partial | 167 | 3-506(+) |
Amino Acid sequence : | |||
| TRPHTLQPHPTTDHQQIHTHKKGKEIKKHQDSRRRRIRVSFSFPQSLDSSFMVSAEELEQQQQQQGMALPGLVASLTAGGGSGSSSSAEDPSKKIRKPYTITKSRESWTEQEHDKFLEAL QLFDRDWKKIEAFIGSKTVIQSCQTLLKYTISLEVYSTQIQVVICKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 13,284.111 | ||
| Theoretical pI: | 5.257 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26970 | ||
| Instability index: | 42.323 | ||
| aromaticity | 0.109 | ||
| GRAVY | 0.129 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.269 | ||
| sheet | 0.193 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145901.1 | complete | 119 | 493-134(-) |
Amino Acid sequence : | |||
| MTTCIWVEYTSNEIVYFSKVWHDWITVFDPINASIFFQSRSKSWRASRNLSCSCSVQLSLDLVIVYGFRIFLLGSSAEEEDPLPPPAVRDATSPGKAIPCCCCCCSNSSADTIKLESKL* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,284.111 | ||
| Theoretical pI: | 5.257 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26970 | ||
| Instability index: | 42.323 | ||
| aromaticity | 0.109 | ||
| GRAVY | 0.129 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.269 | ||
| sheet | 0.193 | ||