Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145901.1 | 5prime_partial | 167 | 3-506(+) |
Amino Acid sequence : | |||
TRPHTLQPHPTTDHQQIHTHKKGKEIKKHQDSRRRRIRVSFSFPQSLDSSFMVSAEELEQQQQQQGMALPGLVASLTAGGGSGSSSSAEDPSKKIRKPYTITKSRESWTEQEHDKFLEAL QLFDRDWKKIEAFIGSKTVIQSCQTLLKYTISLEVYSTQIQVVICKN* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 13,284.111 | ||
Theoretical pI: | 5.257 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26970 | ||
Instability index: | 42.323 | ||
aromaticity | 0.109 | ||
GRAVY | 0.129 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.269 | ||
sheet | 0.193 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145901.1 | complete | 119 | 493-134(-) |
Amino Acid sequence : | |||
MTTCIWVEYTSNEIVYFSKVWHDWITVFDPINASIFFQSRSKSWRASRNLSCSCSVQLSLDLVIVYGFRIFLLGSSAEEEDPLPPPAVRDATSPGKAIPCCCCCCSNSSADTIKLESKL* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,284.111 | ||
Theoretical pI: | 5.257 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26970 | ||
Instability index: | 42.323 | ||
aromaticity | 0.109 | ||
GRAVY | 0.129 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.269 | ||
sheet | 0.193 |