| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145912.1 | 5prime_partial | 159 | 3-482(+) |
Amino Acid sequence : | |||
| TSIGAATSPTRHPCSAHQVMYELRVYSLEEATFGSVLASRAIRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIPSAEDEVNVACFHPLVG GGLVYGTKEGKLRVLQFYGSQDASCKETNHFLEESMLES* | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 17,473.735 | ||
| Theoretical pI: | 5.764 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10680 | ||
| Instability index: | 46.030 | ||
| aromaticity | 0.075 | ||
| GRAVY | 0.060 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.220 | ||
| sheet | 0.283 | ||