Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145916.1 | internal | 122 | 3-368(+) |
Amino Acid sequence : | |||
GVTILPLLSQIKPPCSFTSQEISYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAAKFADACLRGLRGDADIVECSFVASHVTELPFFATKVRLGRTGVEEIFPLGPFNELERAGMEKAKK EL | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,022.813 | ||
Theoretical pI: | 5.425 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 39.158 | ||
aromaticity | 0.074 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.221 | ||
sheet | 0.328 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145916.1 | internal | 122 | 3-368(+) |
Amino Acid sequence : | |||
GVTILPLLSQIKPPCSFTSQEISYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAAKFADACLRGLRGDADIVECSFVASHVTELPFFATKVRLGRTGVEEIFPLGPFNELERAGMEKAKK EL | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,022.813 | ||
Theoretical pI: | 5.425 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 39.158 | ||
aromaticity | 0.074 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.221 | ||
sheet | 0.328 |