| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145916.1 | internal | 122 | 3-368(+) |
Amino Acid sequence : | |||
| GVTILPLLSQIKPPCSFTSQEISYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAAKFADACLRGLRGDADIVECSFVASHVTELPFFATKVRLGRTGVEEIFPLGPFNELERAGMEKAKK EL | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,022.813 | ||
| Theoretical pI: | 5.425 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 39.158 | ||
| aromaticity | 0.074 | ||
| GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.221 | ||
| sheet | 0.328 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145916.1 | internal | 122 | 3-368(+) |
Amino Acid sequence : | |||
| GVTILPLLSQIKPPCSFTSQEISYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAAKFADACLRGLRGDADIVECSFVASHVTELPFFATKVRLGRTGVEEIFPLGPFNELERAGMEKAKK EL | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,022.813 | ||
| Theoretical pI: | 5.425 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 39.158 | ||
| aromaticity | 0.074 | ||
| GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.221 | ||
| sheet | 0.328 | ||