| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145929.1 | internal | 213 | 3-641(+) |
Amino Acid sequence : | |||
| KDPVRVLVTGAAGQIGYALVPMIARGVMLGPDQPVILHMLDIPPAVESLNGVKMELVDAAFPLLKGVVATTDVVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEKYAA ANCKVLVVANPANTNALILKEFAPSIPEKNITCLTRLDHNRALGQISERLNVQVSDVKNVVIWGNHSSTQYPDVSHATVKTANGEKPVPELVS | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 22,704.171 | ||
| Theoretical pI: | 7.881 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 32.853 | ||
| aromaticity | 0.038 | ||
| GRAVY | 0.125 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.249 | ||
| sheet | 0.272 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145929.1 | internal | 213 | 3-641(+) |
Amino Acid sequence : | |||
| KDPVRVLVTGAAGQIGYALVPMIARGVMLGPDQPVILHMLDIPPAVESLNGVKMELVDAAFPLLKGVVATTDVVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEKYAA ANCKVLVVANPANTNALILKEFAPSIPEKNITCLTRLDHNRALGQISERLNVQVSDVKNVVIWGNHSSTQYPDVSHATVKTANGEKPVPELVS | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 22,704.171 | ||
| Theoretical pI: | 7.881 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 32.853 | ||
| aromaticity | 0.038 | ||
| GRAVY | 0.125 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.249 | ||
| sheet | 0.272 | ||