| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145936.1 | internal | 198 | 1-594(+) |
Amino Acid sequence : | |||
| SLSSQESDTNNDRMIAIALSEEYAKLDGAVARRVSNLSSVPHIPRINAFFPTLSDASLDHHRLIQRLNTYGLFEVKVSGDGNCQFRAISDQLYRSPDHHKHVRKEVVKQLKEFRSLYESY VPMKYKRYYKKMSKPGEWGDHVTLQAAADKFGAKICLLTSFRDTCFVEIVPQNQAPQRELWLSFWSEVHYNSLYDLRD | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 22,960.707 | ||
| Theoretical pI: | 8.682 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
| Instability index: | 42.718 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.554 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.217 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145936.1 | internal | 198 | 1-594(+) |
Amino Acid sequence : | |||
| SLSSQESDTNNDRMIAIALSEEYAKLDGAVARRVSNLSSVPHIPRINAFFPTLSDASLDHHRLIQRLNTYGLFEVKVSGDGNCQFRAISDQLYRSPDHHKHVRKEVVKQLKEFRSLYESY VPMKYKRYYKKMSKPGEWGDHVTLQAAADKFGAKICLLTSFRDTCFVEIVPQNQAPQRELWLSFWSEVHYNSLYDLRD | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 22,960.707 | ||
| Theoretical pI: | 8.682 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
| Instability index: | 42.718 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.554 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.217 | ||
| sheet | 0.232 | ||