| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145939.1 | internal | 120 | 3-362(+) |
Amino Acid sequence : | |||
| TREDLILINYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKTKSEPLDYQNQQMMMVDDASTSH | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 14,209.043 | ||
| Theoretical pI: | 9.995 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 52.614 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.951 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.225 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145939.1 | internal | 120 | 3-362(+) |
Amino Acid sequence : | |||
| TREDLILINYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKTKSEPLDYQNQQMMMVDDASTSH | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 14,209.043 | ||
| Theoretical pI: | 9.995 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 52.614 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.951 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.225 | ||
| sheet | 0.233 | ||