| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145944.1 | 5prime_partial | 101 | 3-308(+) |
Amino Acid sequence : | |||
| VAEVIKLFCDDSKRMLNELTKLLDQPVADFRKVDGYVHQLKGSSSSIGAQKVTLACIQFRHFCDGNNKEGCLRALNVVKHEFYHLQSKFQIMAQMETRILT* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,545.298 | ||
| Theoretical pI: | 8.757 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 41.576 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.198 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.158 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145944.1 | 5prime_partial | 101 | 3-308(+) |
Amino Acid sequence : | |||
| VAEVIKLFCDDSKRMLNELTKLLDQPVADFRKVDGYVHQLKGSSSSIGAQKVTLACIQFRHFCDGNNKEGCLRALNVVKHEFYHLQSKFQIMAQMETRILT* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,545.298 | ||
| Theoretical pI: | 8.757 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 41.576 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.198 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.158 | ||
| sheet | 0.248 | ||