| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145957.1 | 5prime_partial | 143 | 1-432(+) |
Amino Acid sequence : | |||
| VKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVELPLANLLYSFNWELPAGIFKDDIN MDESPGIAIHRKYALHLVAKRYK* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 16,437.871 | ||
| Theoretical pI: | 7.118 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 36.956 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.244 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.231 | ||
| sheet | 0.266 | ||