| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145965.1 | internal | 104 | 2-313(+) |
Amino Acid sequence : | |||
| EVEDLEAAGIQVIQIDEAALREGLPLRKTEQAFYQDWAVHSFRITNCGVKDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGI | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,001.110 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 35.697 | ||
| aromaticity | 0.038 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.231 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145965.1 | internal | 104 | 313-2(-) |
Amino Acid sequence : | |||
| DTSTVLHSLTENGEELLIGTGVLDGDHIGIHVDDGVDDVVEVGVAHMCVDLSSVLDSTVCDSEGVDSPVLIESLLSLAKRQAFPKGCFIDLDDLNTSGFQILDF | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,001.110 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 35.697 | ||
| aromaticity | 0.038 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.231 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145965.1 | internal | 104 | 2-313(+) |
Amino Acid sequence : | |||
| EVEDLEAAGIQVIQIDEAALREGLPLRKTEQAFYQDWAVHSFRITNCGVKDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGI | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,001.110 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 35.697 | ||
| aromaticity | 0.038 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.231 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145965.1 | internal | 104 | 313-2(-) |
Amino Acid sequence : | |||
| DTSTVLHSLTENGEELLIGTGVLDGDHIGIHVDDGVDDVVEVGVAHMCVDLSSVLDSTVCDSEGVDSPVLIESLLSLAKRQAFPKGCFIDLDDLNTSGFQILDF | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,001.110 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 35.697 | ||
| aromaticity | 0.038 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.231 | ||
| sheet | 0.231 | ||