| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145967.1 | 5prime_partial | 149 | 2-451(+) |
Amino Acid sequence : | |||
| HYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGILVVELPLANLLYSFNWELPAGI FKDDINMDESPGIAIHRKYALHLVAKRYK* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 17,207.868 | ||
| Theoretical pI: | 7.915 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 38.973 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.183 | ||
Secondary Structure Fraction | |||
| Helix | 0.342 | ||
| turn | 0.221 | ||
| sheet | 0.262 | ||