Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145989.1 | 5prime_partial | 165 | 3-500(+) |
Amino Acid sequence : | |||
TRNAKVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELST QDKELAGISPGLVRMSVGYSGTIDQRWGQFEKAISRMQVDVHAKN* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 15,465.019 | ||
Theoretical pI: | 8.714 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 65.506 | ||
aromaticity | 0.014 | ||
GRAVY | -1.230 | ||
Secondary Structure Fraction | |||
Helix | 0.165 | ||
turn | 0.317 | ||
sheet | 0.194 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145989.1 | 5prime_partial | 139 | 2-421(+) |
Amino Acid sequence : | |||
HEECQGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEH SGQGACRHLPRTSQDVCRL* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 15,465.019 | ||
Theoretical pI: | 8.714 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 65.506 | ||
aromaticity | 0.014 | ||
GRAVY | -1.230 | ||
Secondary Structure Fraction | |||
Helix | 0.165 | ||
turn | 0.317 | ||
sheet | 0.194 |